
Immunoassay and Immunology Controls
Calibrators, controls, panels, kits, and other materials used to monitor the performance and ensure the accuracy of diagnostic immunoassay and immunology tests.
Detectable Analytes
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (2)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (1)
- (2)
- (1)
- (1)
- (1)
- (1)
Sample Type
- (2)
- (3)
- (1)
- (12)
- (1)
- (1)
- (1)
- (2)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
Form
- (12)
Conjugate
- (7)
Applications
- (5)
- (6)
- (4)
- (6)
Filtered Search Results
Products from some of our suppliers do not display in filtered search results. Please
clear all filters
to see these products.

271
–
285
of
535
results
Intended Use | For research use only |
---|
SeraCare™ HCV RNA Linearity Panel
Serial dilutions of high titer HCV RNA plasma in HCV RNA negative pooled plasma
SeraCare™ ACCURUN™ 155 Anti-Treponema pallidum (Syphilis) Positive Control
Designed to closely mimic human samples for accuracy and efficiency
Type | ACCURUN 155 Anti-Treponema Pallidum Positive Control |
---|---|
Content And Storage | 2°C to 8°C |
Certifications/Compliance | IVD, CE, HC |
Intended Use | Qualitative determination of IgG Antibodies to Treponema pallidum (Syphilis) |
Type | Seroconversion Panel |
---|---|
Intended Use | For research use only |
SeraCare™ ACCURUN™ 125 Anti-HBs Positive Control Kit
For qualitative detection of antibodies to Hepatitis B surface antigen
Invitrogen™ Human Thromboxane synthase (aa 276-331) Control Fragment Recombinant Protein
Recombinant Protein

Encompass Procurement Services
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
Regulatory Status | RUO |
---|---|
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
Conjugate | Unconjugated |
Form | Liquid |
Formulation | 1 M urea, PBS with no preservative; pH 7.4 |
Sequence | RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI |
Concentration | ≥5.0 mg/mL |
For Use With (Application) | Blocking Assay,Control |
Name | Human Thromboxane synthase (aa 276-331) Control Fragment |
Recombinant | Recombinant |
SeraCare™ ACCURUN™ QC Serology Multi-Marker Negative Controls

Simplify testing by using one control vial for analytes commonly grouped in one laboratory area
Content And Storage | 2°C to 8°C |
---|---|
For Use With (Equipment) | Any system |
Certifications/Compliance | IVD, CE, HC |
SeraCare™ ACCURUN™ 190 Anti-Trypanosoma cruzi (Chagas) Positive Control
Enhances the quality and precision of Chagas test results, day-to-day and run-to-run
Fujifilm Medical Systems μTASWako DCP Control High
For use with the μTASWako i30 Immunoanalyzer System
SeraCare™ ACCURUN™ QC Blood Donor Confirmatory Control
Independent run control specifically intended for use with supplemental (confirmatory) tests for blood screening